PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g55303.1.p
Common NameBRADI_2g55303
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 362aa    MW: 39342.6 Da    PI: 9.026
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g55303.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.67.9e-1063981248
                      HHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding 12 lvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      l +  +++G g W++I ++++ gR +kqc+ rw ++l
  Bradi2g55303.1.p 63 LREMMNMYGEGKWAAIVKHLP-GRIGKQCRARWMNHL 98
                      7788899**************.*************97 PP

2Myb_DNA-binding52.11.5e-16107148346
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       +WT+e+d+ l++ +  lG++ W+ Iar+++ gR+++++k++w+ 
  Bradi2g55303.1.p 107 PWTEEDDKALIQEHMTLGNR-WSEIARHLP-GRSENSVKNHWNA 148
                       7*******************.*********.***********95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007171.4E-551100IPR001005SANT/Myb domain
PROSITE profilePS512948.4865498IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.6E-1661100IPR009057Homeodomain-like
PfamPF002495.7E-96298IPR001005SANT/Myb domain
CDDcd001671.37E-96298No hitNo description
SuperFamilySSF466891.76E-2578151IPR009057Homeodomain-like
PROSITE profilePS5129419.78599154IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-18101149IPR009057Homeodomain-like
SMARTSM007174.5E-15104152IPR001005SANT/Myb domain
CDDcd001671.14E-13107147No hitNo description
PfamPF002494.8E-15107148IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MGLLDVGFDM APTNFAMPAK GALAATGGTS PVEAATVPRR PRTVRNNRDR HCNPVRVLKG  60
AILREMMNMY GEGKWAAIVK HLPGRIGKQC RARWMNHLRP ELKKDAPWTE EDDKALIQEH  120
MTLGNRWSEI ARHLPGRSEN SVKNHWNAVR RSLGATRQFK KKKSEQPPPG EFTVLEQYIR  180
SKYPPSIEPT SPPPSGPASP SSGGPGSPNA AAPLALAGSS QTGMDMNFEY SAGSSNGGMT  240
NLNAPLLLPG LNTYNSFPNI SNLQYEMQVP ALPVMVGTTD QEHLQAAPAY MNQLLNVPPM  300
GTAHHQGNLP NLVKFEGQPT YYSEAAMGPS CTGELDDVVQ MASREFATPS EDKVTFDPSK  360
F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A5e-336515117102MYB PROTO-ONCOGENE PROTEIN
1mse_C5e-336515117102C-Myb DNA-Binding Domain
1msf_C5e-336515117102C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0Q3GHR80.0A0A0Q3GHR8_BRADI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.13e-37myb domain protein 98